DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and LOC110438235

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_021324868.1 Gene:LOC110438235 / 110438235 -ID:- Length:199 Species:Danio rerio


Alignment Length:141 Identity:36/141 - (25%)
Similarity:57/141 - (40%) Gaps:20/141 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 NKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHF 300
            |.:...|:.|..:|          |..|...|...|..|.||:...|...::..|::...| ...
Zfish     6 NDYCYLLITLSMRR----------WADARSDCLNQGGDLLSITEPFEQGYIQAVIQNIPTG-VSL 59

  Fly   301 WISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSF 365
            |:...|...||.:.| ..|.|..:.||.||.|:::     ..|:||.:....|   .|||..|..
Zfish    60 WMGAHDQVTEGGWTW-TDGSPFRYINWAAGNPDDY-----YGEDCLSILINSG---AWNDDNCEN 115

  Fly   366 ETYFVCEVQPN 376
            :..::|:.:.|
Zfish   116 KRGYICKRRGN 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 32/123 (26%)
LOC110438235XP_021324868.1 CLECT 8..123 CDD:153057 34/134 (25%)
Gal_Lectin 150..>174 CDD:307994
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.