DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and LOC103911722

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_009303414.1 Gene:LOC103911722 / 103911722 -ID:- Length:674 Species:Danio rerio


Alignment Length:287 Identity:61/287 - (21%)
Similarity:109/287 - (37%) Gaps:55/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LGQNNHISSSSN--ISRSGGGNGRDKRGAQLDPSEIARQNQITQQIFANYLERRLFPNRTANQKI 104
            |.:||.::....  :.|:   |...|...|:    :.|.|.||::                .::|
Zfish   387 LKRNNDLTKEKEQILKRN---NDLTKEKEQI----LKRNNDITKE----------------KEQI 428

  Fly   105 PTIADILPKPKPSPRPRPRGFAASDGGNFKRSGGGAQRNRLAAAASKRQSGYNRKRLREEQEE-- 167
            .|..:.|.|.|.....|............||:      |.|  ...|.|.......|.:|:|:  
Zfish   429 LTRNNELTKEKEQILKRNNDLTKEKEQILKRN------NDL--TKEKEQILKRNNDLTKEKEQIL 485

  Fly   168 EEEADDQERDQQPLANQEDFDYDVQESLQ-----SVESEQHDQYYGNIF-HRDPSENEVDNDCPN 226
            :...|..:..:|.|.:..|...:.::.|:     :.|.||..:...::. .||...|| .|...:
Zfish   486 KRNNDLTKEKEQILKSNNDLTKEREQILKRNNDLTKEKEQILKSNNDLTKERDKIRNE-QNQLRH 549

  Fly   227 CV-DESQYTPN-KWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKH 289
            .: ::.|.:.| ||    :......||:. |.|.:|..:.:.|:.....||.|.|.||...|:|.
Zfish   550 WLHEQDQLSDNFKW----IYFSSSFYYIS-FEKKSWEDSRRDCQQRRADLAIIKSTEEKTFLQKV 609

  Fly   290 IRDFGLGHEHFWISGTDLADEGNFFWM 316
            ::     :.:.|: |....:..|:.|:
Zfish   610 LQ-----NNNLWV-GWRQTNGDNWIWI 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 18/68 (26%)
LOC103911722XP_009303414.1 COG1340 210..505 CDD:224259 29/148 (20%)
CLECT_NK_receptors_like 562..669 CDD:153063 20/80 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.