DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and CLEC4M

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_055072.3 Gene:CLEC4M / 10332 HGNCID:13523 Length:399 Species:Homo sapiens


Alignment Length:239 Identity:58/239 - (24%)
Similarity:99/239 - (41%) Gaps:45/239 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 RLAAAASKRQSGYNRKRLREEQEEEEEADDQERDQQPLANQEDFDYDVQESLQSVESEQHDQYYG 208
            ||.||..:.......:.:.:|..|.:.|..:..::..|  ||  .|.....|::...|..||...
Human   187 RLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKL--QE--IYQELTQLKAAVGELPDQSKQ 247

  Fly   209 NIFHRDPSE--NEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLG-IFF----KANWFKATQY 266
            ...:::.::  ...:..|.:|       |..||          ::.| .:|    :.||..:...
Human   248 QQIYQELTDLKTAFERLCRHC-------PKDWT----------FFQGNCYFMSNSQRNWHDSVTA 295

  Fly   267 CRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPI--TFTN-WN 328
            |:.....|..|.:.||.:.|:...   ...:...|:..:||..||.:.|: .|.|:  :|.. ||
Human   296 CQEVRAQLVVIKTAEEQNFLQLQT---SRSNRFSWMGLSDLNQEGTWQWV-DGSPLSPSFQRYWN 356

  Fly   329 AGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
            :|||||    :|.|: |.|.   .|.|  |||:.|..:.|::|:
Human   357 SGEPNN----SGNED-CAEF---SGSG--WNDNRCDVDNYWICK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 38/132 (29%)
CLEC4MNP_055072.3 Endocytosis signal. /evidence=ECO:0000250 14..15
transmembrane domain 44..71
7 X approximate tandem repeats 108..269 17/92 (18%)
DUF342 <140..251 CDD:302792 15/67 (22%)
CLECT_DC-SIGN_like 268..391 CDD:153060 42/154 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150816
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.