DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and LOC101885796

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_021323879.1 Gene:LOC101885796 / 101885796 -ID:- Length:264 Species:Danio rerio


Alignment Length:280 Identity:67/280 - (23%)
Similarity:101/280 - (36%) Gaps:86/280 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SSSNISRSGGGNGRD---KRGAQLDP--SEIARQNQITQQIFAN-------YLERRLF------- 95
            ||:.::.|    .||   .|||.|..  |:..:.:.:::|||..       |....:|       
Zfish    11 SSNRLNWS----SRDACVSRGADLVTIISQSEQHSSVSEQIFCQTHEMESIYENSAIFLSTVASS 71

  Fly    96 ----PNR---TANQKIPTIADILPKPKPSPRPRPRGFAASDGGNFKRSGGG------AQRNRLAA 147
                ||:   |:|:.:....|...| :.|...:...|..  |.....|.||      ...|.||.
Zfish    72 EECSPNKEKSTSNECVREREDTSSK-RTSKITKVLLFVL--GFTLVISLGGLCALWIIYTNALAD 133

  Fly   148 AASKRQ----SGYNRKRLREE--QEEEEEADDQERDQQPL----ANQEDFD-----YDVQESLQS 197
            :.|.::    ...|.|.||::  :|.||..|:....::.|    |.:|:|.     |.:...|.|
Zfish   134 SGSLKEQLSAQKLNSKTLRDDLMRELEELKDNYTHVREHLVLCVAMKEEFHDLTSRYKILRDLLS 198

  Fly   198 VESEQHDQYYGNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFK 262
                    ||               |..:|    ..:.|.||....:|    ||... .|.|||.
Zfish   199 --------YY---------------DAQSC----NVSANGWTACRGQL----YYFST-SKLNWFS 231

  Fly   263 ATQYCRYHGMHLASISSQEE 282
            :...|...|..|.:|:||.|
Zfish   232 SRDACVSRGADLVTITSQSE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 13/34 (38%)
LOC101885796XP_021323879.1 CLECT 5..>40 CDD:321932 10/32 (31%)
CLECT 211..>252 CDD:321932 16/46 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.