DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and si:ch73-111e15.1

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_005172686.1 Gene:si:ch73-111e15.1 / 101885260 ZFINID:ZDB-GENE-110411-28 Length:271 Species:Danio rerio


Alignment Length:202 Identity:47/202 - (23%)
Similarity:78/202 - (38%) Gaps:41/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 NQEDFDYDVQESLQSVE--SEQHDQYYGNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKL 245
            ||.::..:..:.|..:.  :|..|:...||      ||.: .|....:.:.|.... ||      
Zfish    91 NQPNYPEERHQLLTKITNLTENKDELLTNI------ENLL-KDREQLIQQHQIIAG-WT------ 141

  Fly   246 GEKRYYLGIFF-----KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGT 305
                |:...|:     ..:|..:...|:.....|.:|::::|.|.:....|     ::.|||..|
Zfish   142 ----YFQSSFYYLSNESKSWTDSRGDCKGRKADLITINNRQEQDFVMTLTR-----NKEFWIGLT 197

  Fly   306 DLADEGNFFWMATGRPITFTNW----NAGEPNNFRYENGEEENC-LELWNRDGKGLKWNDSPCSF 365
            |...||.:.|: .|..:|...|    :..|||     .|..||| |....|..:.:.|.|..|..
Zfish   198 DSEKEGQWKWV-DGSTLTTGFWASFRSITEPN-----GGTRENCVLTHLKRHPELIGWIDHNCDA 256

  Fly   366 ETYFVCE 372
            ...::||
Zfish   257 SYQWICE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 34/134 (25%)
si:ch73-111e15.1XP_005172686.1 CLECT_DC-SIGN_like 139..264 CDD:153060 36/147 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.