DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and LOC101884413

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_021327946.1 Gene:LOC101884413 / 101884413 -ID:- Length:292 Species:Danio rerio


Alignment Length:226 Identity:59/226 - (26%)
Similarity:95/226 - (42%) Gaps:72/226 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 QSGYNRKRLREEQEEEEEADDQERDQQPLANQEDFDYDVQESLQSVESEQHDQYYGNIFHRDPSE 217
            |:..:.|.:|..||::|          .|:|::|.            .:|.|       |.:..:
Zfish   128 QNQLHAKNIRLTQEKDE----------LLSNEQDL------------IKQRD-------HLNQEK 163

  Fly   218 NEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYY---LGIFF--KANWFKATQYCRYHGMHLASI 277
            ||                      |||: |..||   |..||  |.:|.::.:|||.||..|..|
Zfish   164 NE----------------------LLKM-EWIYYRSNLYYFFKLKKSWTESRRYCRNHGADLVII 205

  Fly   278 SSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGE- 341
            :::||.|.::|.     ...|..||..:|...||::.|:...:|.::. |:.|||::   ..|: 
Zfish   206 NNREEQDFVDKI-----TAGEKAWIGLSDSDVEGSWKWVDDSKPTSWI-WHYGEPSS---GGGQV 261

  Fly   342 EENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
            ||:|:.....     .|.|.||..|..::||
Zfish   262 EEDCVLTVTS-----AWADYPCDAEFQWICE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 41/130 (32%)
LOC101884413XP_021327946.1 SH3_and_anchor <97..174 CDD:275056 18/97 (19%)
CLECT_DC-SIGN_like 170..288 CDD:153060 42/132 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.