DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and LOC101882781

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_005155516.1 Gene:LOC101882781 / 101882781 -ID:- Length:278 Species:Danio rerio


Alignment Length:202 Identity:49/202 - (24%)
Similarity:76/202 - (37%) Gaps:46/202 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 RLREEQEE---EEEADDQERDQQPLANQEDFDYDVQESLQSVESEQHDQYYGNIFHRDPSENEV- 220
            :|.||||:   :.:...:||:|....|.:             .||:.:|.:.||.:.......: 
Zfish    86 KLNEEQEQLLNDNKVLTEEREQLLKYNND-------------LSEEREQIFTNITNLKGERERLL 137

  Fly   221 --DNDCPNCVDESQYTPNKWTM-------PLLKLGEKRYYLGIFF----KANWFKATQYCRYHGM 272
              :||...  :..|...:||.|       |..|.....|...::|    ..:|..:.|.|:....
Zfish   138 NHNNDLTK--ERDQLRNDKWKMWPYEQDLPADKFRWICYNNSLYFISSEMKSWSDSRQDCQQRRA 200

  Fly   273 HLASISSQEENDRLEKHI-RDFGLGHEHF----WISGTDL-----ADEGNFFWMATGRPITFTNW 327
            .||.|.|.||....:|.: |:|.:|....    |:.||.|     .|..|...:|.|...|    
Zfish   201 DLAIIKSPEEKTFFQKVVDRNFWIGLTKTDVWKWLDGTVLTNGSKTDSSNCAVVAAGGYYT---- 261

  Fly   328 NAGEPNN 334
            :|...||
Zfish   262 SACNSNN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 27/100 (27%)
LOC101882781XP_005155516.1 CLECT_NK_receptors_like 170..274 CDD:153063 27/103 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.