DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and asgrl2

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_005170656.1 Gene:asgrl2 / 101882127 ZFINID:ZDB-GENE-080917-52 Length:299 Species:Danio rerio


Alignment Length:291 Identity:66/291 - (22%)
Similarity:105/291 - (36%) Gaps:69/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 PSPRPRPRGFAASDGGNFKRSGGGAQRNRLAA--------AASKRQSGYNRKRLREE-------- 164
            ||.|   |..|...||.::...|.|  ..:||        ..|.....:|||....|        
Zfish    38 PSVR---RLAAVPSGGRWRWCAGIA--GSVAALMLLLLIITVSVNHVKFNRKFSATEVRIQNLTQ 97

  Fly   165 ---------QEEEEEADDQERDQQPLANQEDFDYDVQESLQS--VESEQ--HDQYYGNIFHRDPS 216
                     ||.|:.......|...|    :||..:.|:..:  :||.|  ||:......|.|..
Zfish    98 IILNVISRTQELEQFGHKINADVSSL----EFDQRMTETSMNNLLESAQALHDKVSELKCHIDKM 158

  Fly   217 ENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKA---NWFKATQYCRYHGMHLASIS 278
            .|  :|....|      .|::|:     |.....|   ||..   :|..|...|......|..::
Zfish   159 RN--NNTQELC------CPDQWS-----LFSSNCY---FFSTDGMSWDSARDECERKRAKLLILT 207

  Fly   279 SQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWM-ATGRPITFTNWNAGEPNNFRYEN-GE 341
            |:.|...:....:..     .:|:..|| ...|.:.|: .|...:..:.|..|:|:|::... |.
Zfish   208 SKLEKSFVVSKTKPL-----FYWLGLTD-GRTGEWEWLDETPYEMVRSEWRPGQPDNWKAHGLGG 266

  Fly   342 EENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
            .|:|.. ::.||   ::||..||....::|:
Zfish   267 GEDCAH-FHHDG---RYNDDHCSRHYRYICK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 29/129 (22%)
asgrl2XP_005170656.1 zf-C4H2 <108..>165 CDD:313386 16/62 (26%)
CLECT_DC-SIGN_like 168..293 CDD:153060 31/142 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.