DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and LOC101734545

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_031750858.1 Gene:LOC101734545 / 101734545 -ID:- Length:471 Species:Xenopus tropicalis


Alignment Length:244 Identity:55/244 - (22%)
Similarity:80/244 - (32%) Gaps:78/244 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 AQRNRLAAAASKRQSGYNRKR------LREEQEEEEEADDQERDQQPLANQEDFDYDVQESLQSV 198
            :.:.:...||.|..|...|:.      |||.:...||.  :|.|.|...|.........|..|.|
 Frog   230 SDKTKKLEAAQKTLSDTQRELLTVRNVLRETERNLEET--RESDAQRGKNLSALQQRWSEVQQCV 292

  Fly   199 ESEQHDQYYGNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKA 263
            ..|.         |::......|       |...|.|:.|.    ::|::.||..        ..
 Frog   293 SCEN---------HKNGESGAYD-------DPFDYCPDVWE----QIGDQCYYFS--------SE 329

  Fly   264 TQY-------CRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEG--NFFWMATG 319
            :||       ||..|..||.:  :|.:|.|:|.|   ......:||....:..:|  |.|     
 Frog   330 SQYRLQSETACRSSGAVLAKL--EESDDILKKMI---AKSSRSYWIGLKKVEHQGQTNLF----- 384

  Fly   320 RPITFTNW--NAGE-----PNNFRYENGEE---ENCLELWNRDGKGLKW 358
                  .|  |:.:     ||.|..:...|   |.|.:|       |.|
 Frog   385 ------RWSDNSSQTLESLPNQFCAKATPELKAETCSKL-------LPW 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 30/129 (23%)
LOC101734545XP_031750858.1 Smc <87..>306 CDD:224117 19/86 (22%)
CLECT 312..424 CDD:413318 33/144 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.