DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and LOC100537194

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_017211404.1 Gene:LOC100537194 / 100537194 -ID:- Length:306 Species:Danio rerio


Alignment Length:232 Identity:56/232 - (24%)
Similarity:93/232 - (40%) Gaps:38/232 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 NRLAAAASKRQSGYNRKRLREEQEEEEEADDQERDQQPLANQEDFDYDVQESLQSVESEQHDQYY 207
            |.|:....:.::.||...|.:.|.|::......:..|           ::.|:..: |.|..|..
Zfish   110 NSLSLGKHQLETKYNSLSLEKHQLEDKYNSLSLKKHQ-----------LETSVDEL-SAQKSQLQ 162

  Fly   208 GNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFF--KANWFKATQYCRYH 270
            .|.......:.|::|...:..||              |.:.|...|.||  :.:|.::.|:||..
Zfish   163 NNSNSLSQKKLELENRVTSLSDE--------------LKKARSKQGWFFTEEKSWSESRQFCRNR 213

  Fly   271 GMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNF 335
            |..|..|.|:.:...:...::      |..||..:|...||...|: ...|:....|..|||||:
Zfish   214 GAELVIIKSEVKQRVISSLVK------EDVWIGLSDTETEGTMKWV-DNSPMNQGFWARGEPNNY 271

  Fly   336 RYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
            |   .::|:|:|:....|....|||..||.....:||
Zfish   272 R---SQDEDCVEVRISQGIPNNWNDLRCSDRRKGICE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 38/126 (30%)
LOC100537194XP_017211404.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.