DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and clec3bb

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_003200569.1 Gene:clec3bb / 100537161 ZFINID:ZDB-GENE-111027-16 Length:200 Species:Danio rerio


Alignment Length:234 Identity:50/234 - (21%)
Similarity:83/234 - (35%) Gaps:68/234 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 ASKRQSGYNRKRLREEQEEEEEADDQERD-QQPLANQEDFDYDVQESLQSVESEQHDQ------- 205
            :|.:|...::|:..::::.|........| ||.::       |:.|.|..::.:|..|       
Zfish    21 SSLQQQNTSKKKTPDKKDSESRVSAALEDLQQQIS-------DIVEELNLLKEQQALQTVCLKGT 78

  Fly   206 -YYGNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRY 269
             .:|..|..|..                              :|||:          .|.:.|..
Zfish    79 KIHGKCFLADSM------------------------------KKRYH----------TANEDCIA 103

  Fly   270 HGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWM-ATGRPITFTNWNAGEPN 333
            .|..||:..|..:|.:|.:::|.........|:...|:..||  .|. .||..|.:.||...:| 
Zfish   104 KGGILATPLSSAQNTQLYEYMRQSISADAEIWLGVNDMQTEG--LWTDQTGSAIRYKNWKLPQP- 165

  Fly   334 NFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
                :.|..:||..|.:    |.||.|..|..|...:||
Zfish   166 ----DGGSAQNCAVLTS----GGKWLDESCREERASICE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 34/125 (27%)
clec3bbXP_003200569.1 CLECT 74..197 CDD:295302 38/174 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.