DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and LOC100496055

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_017951541.1 Gene:LOC100496055 / 100496055 -ID:- Length:281 Species:Xenopus tropicalis


Alignment Length:112 Identity:40/112 - (35%)
Similarity:53/112 - (47%) Gaps:16/112 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 KATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISG-TDLADEGNFFWMATGRPITFT 325
            |||  |......|||..:..||    |.|....|.:....:.| .|..:||.|.:: ....|.|:
 Frog   183 KAT--CTKAEGQLASPMNDAEN----KAISILSLQYNKPVVLGIDDKQNEGTFKYL-NNEKIVFS 240

  Fly   326 NWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
            ||..|||||   :||.|: |:||..   .|: |||..|:.:...|||
 Frog   241 NWKPGEPNN---DNGVED-CVELRT---NGI-WNDMNCNSKRLTVCE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 40/112 (36%)
LOC100496055XP_017951541.1 Collagen 60..118 CDD:189968
Surfac_D-trimer 129..174 CDD:286141
CLECT 167..280 CDD:382969 40/112 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.