DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and LOC100494969

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_031755235.1 Gene:LOC100494969 / 100494969 -ID:- Length:312 Species:Xenopus tropicalis


Alignment Length:232 Identity:63/232 - (27%)
Similarity:92/232 - (39%) Gaps:43/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 AAASKRQSGYNRKRLREEQEEEEEADDQERDQQPLA----NQEDFDYDVQESLQSVESEQHDQYY 207
            |..||..|......|..|:.:.|..|...|.:...|    |.|....:|.|..:.:..::     
 Frog   115 AIGSKNGSQSAELTLEIEKLKREVHDISTRTETEWANITLNMEKLQDEVAELTKKMREQK----- 174

  Fly   208 GNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGM 272
                 ..|:....|||              |.:    |||..||..: ..::||||..:|:....
 Frog   175 -----TLPTSASCDND--------------WHL----LGESCYYFSV-TSSDWFKARAFCKTKES 215

  Fly   273 HLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWM-ATGRPITFTNWNAGEPNNFR 336
            .|..||:..|...:...|:..||....|||..||:..||.:.|: .|.....|..|.|||||   
 Frog   216 DLVVISTAFEQTAINNIIKAKGLELTRFWIGLTDMNSEGTWEWLDGTNYNTAFKFWRAGEPN--- 277

  Fly   337 YENGEEENCLELWNRDGKGLKWNDSPCSF-ETYFVCE 372
             :.|..|:|..: ..:|   :|||..|:: |...:||
 Frog   278 -DAGGNEDCAHI-RTNG---EWNDVHCTYAECNAICE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 41/126 (33%)
LOC100494969XP_031755235.1 CLECT_DC-SIGN_like 182..310 CDD:153060 48/155 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48976
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.