DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and LOC100487836

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_017948017.1 Gene:LOC100487836 / 100487836 -ID:- Length:383 Species:Xenopus tropicalis


Alignment Length:261 Identity:66/261 - (25%)
Similarity:105/261 - (40%) Gaps:75/261 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 AASKRQSGYNRKRLREEQE----EEEEADDQERDQQPLANQEDFDYDVQESLQSVESEQHDQYYG 208
            |::|.|... :..:||..:    :.:||..:||:.     :||.. .:.::|.|:|.        
 Frog   165 ASTKGQDSL-KADIREINKTLGSQVQEASKEERNL-----KEDLS-KINQTLYSMEM-------- 214

  Fly   209 NIFHRDPSENEVDNDCPNCVDESQYTPNKWTM---------PLLKLGEKRYYLGI---------- 254
                  ||:.:|||      .::|.|..|.|:         .:|||.......||          
 Frog   215 ------PSKKQVDN------LKAQITDFKQTIEKEEKGLLTQILKLKNAIQKQGICKLCPPDWKL 267

  Fly   255 ------FFK---ANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADE 310
                  ||.   .:|..:.|.|:..|..|...:.|.|.|.|.::::     ::.||| |.....:
 Frog   268 VGFNCYFFSKEPKSWADSRQQCQKLGSDLLIFTDQAEVDALYQYMQ-----NKRFWI-GLQRNKD 326

  Fly   311 GNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQP 375
            ..:.|: .|:.:||..|..|||||    .|..|:|.|..:|     .|||..|.....|:||..|
 Frog   327 QKWNWV-DGKALTFNRWGTGEPNN----AGSGEHCGETLSR-----YWNDLKCGDIIDFICEGPP 381

  Fly   376 N 376
            :
 Frog   382 D 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 38/142 (27%)
LOC100487836XP_017948017.1 EnvC 165..>257 CDD:227278 26/118 (22%)
CLECT_DC-SIGN_like 261..378 CDD:153060 35/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.