DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and asgr1

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_002935447.4 Gene:asgr1 / 100487251 XenbaseID:XB-GENE-5998517 Length:211 Species:Xenopus tropicalis


Alignment Length:195 Identity:51/195 - (26%)
Similarity:73/195 - (37%) Gaps:62/195 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 EDFDYDVQESLQSVESEQHDQYYGNIFHRDPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKR 249
            |..|...|:.||:.:.|        |...|....:.|.:|                         
 Frog    71 EAMDTIRQDILQTRQKE--------ICQCDSGWKKFDGNC------------------------- 102

  Fly   250 YYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEK--HIRDFGLGHEH-----FWISGTDL 307
            ||:....| ||.:|...|:.....|..|:|:.|.:.||.  ...:|.:|.:.     .|:.|| |
 Frog   103 YYIVTTMK-NWTEARAICKSMNSDLVVINSEREQNFLESLTDESEFWIGLKRDKDRWRWVDGT-L 165

  Fly   308 ADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
            .:....|||            .|||||    :|.:|:|:.:| ||   .||||..|:|.....||
 Frog   166 HNPSEGFWM------------KGEPNN----SGGKEDCVHMW-RD---KKWNDKVCTFLQKAFCE 210

  Fly   373  372
             Frog   211  210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 41/131 (31%)
asgr1XP_002935447.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.