DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and LOC100363064

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_038945816.1 Gene:LOC100363064 / 100363064 RGDID:2324825 Length:285 Species:Rattus norvegicus


Alignment Length:121 Identity:40/121 - (33%)
Similarity:66/121 - (54%) Gaps:19/121 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 ANWFKATQYCRYHGMHLASISSQEENDRLEKH--IRDFGLGHEHFWISGTDLADEGNFFWMATGR 320
            |:|..:...|:..|.||..|:|..| .|..|:  :|.    ::..||..:|...||::.|: ...
  Rat   170 ASWGASASSCKDLGAHLVIINSVAE-QRFMKYWNVRK----NQRSWIGLSDHLREGSWQWV-DHS 228

  Fly   321 PITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEVQPN 376
            |:.|:.|..|||||    :|:|: |:||:..:     |||:.|:.:.::||| ||:
  Rat   229 PLKFSFWKEGEPNN----DGDED-CVELFMDE-----WNDNTCTQQNFWVCE-QPS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 37/116 (32%)
LOC100363064XP_038945816.1 CLECT_DC-SIGN_like 151..270 CDD:153060 36/115 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.