DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and si:ch211-193e13.5

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_009303416.1 Gene:si:ch211-193e13.5 / 100331104 ZFINID:ZDB-GENE-081104-158 Length:257 Species:Danio rerio


Alignment Length:229 Identity:53/229 - (23%)
Similarity:81/229 - (35%) Gaps:75/229 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 QRNRLAAAASKRQSGYNRKRLREEQEEEEEADDQERDQQPLANQEDFDYDVQESLQSVESEQHDQ 205
            ||..|....||         |.|||||            .|.|....:.:.:|::.::.:     
Zfish    73 QRKHLLTHISK---------LIEEQEE------------ILTNITKLNEEREETITNITN----- 111

  Fly   206 YYGNIFHRDPSENEVDNDCPNCVDESQYTPN-KWTMPLLKLGEKRYYLGIFF-----KANWFKAT 264
               .|..|...:|::|.......::.|.:.| ||.          ||...|:     |.:|..:.
Zfish   112 ---LIEERQQIKNKIDELQLGFYEQDQLSDNFKWI----------YYNFSFYYISSEKKSWEDSR 163

  Fly   265 QYCRYHGMHLASISSQEENDRLEK-HIRDF---GLGHEHF----WISGTDLAD----EGNFFWMA 317
            :.|:.....||.|.|.||...|.| ...||   ||..:|:    |:.|:.|.|    ..:.::.|
Zfish   164 RDCQQRNADLAIIKSPEEKKCLLKVAASDFYWIGLTKKHYRQWNWVDGSLLTDWYFNRHSHYYCA 228

  Fly   318 TGRPITFTNWNAGEPNNFRYENGEEENCLEL--W 349
            .   ||...|             .|::|..|  |
Zfish   229 M---ITSAGW-------------REKSCANLNKW 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 31/120 (26%)
si:ch211-193e13.5XP_009303416.1 DASH_Dad1 69..>106 CDD:285812 14/53 (26%)
CLECT_NK_receptors_like 141..250 CDD:153063 33/132 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.