DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and si:dkeyp-75b4.10

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_002660413.1 Gene:si:dkeyp-75b4.10 / 100320899 ZFINID:ZDB-GENE-090313-394 Length:161 Species:Danio rerio


Alignment Length:154 Identity:45/154 - (29%)
Similarity:71/154 - (46%) Gaps:15/154 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 NEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEE 282
            |.|.:|.||.   |:..|:.|.    |.|.:.:.....:| .|.:|.::|...|.:||||.|...
Zfish    15 NGVKSDVPNI---SRRCPSGWE----KFGSQCFKFFSEYK-TWAEAEKHCVDLGGNLASIQSDIT 71

  Fly   283 NDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLE 347
            ::.|..:::....|....||...|......:|| :.|....::.|::|||||    .|..|.|.|
Zfish    72 HNFLIAYLKRQEKGITRTWIGAHDATQADIWFW-SDGSKFEYSAWHSGEPNN----GGNAERCAE 131

  Fly   348 LWNRDGKGLKWNDSPCSFETYFVC 371
            :...|.:  :|||:.|.....|:|
Zfish   132 MGFGDEQ--RWNDARCETRLNFIC 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 35/123 (28%)
si:dkeyp-75b4.10XP_002660413.1 CLECT 28..153 CDD:295302 38/136 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.