DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and si:ch211-160b11.4

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_021327879.1 Gene:si:ch211-160b11.4 / 100150558 ZFINID:ZDB-GENE-081104-142 Length:315 Species:Danio rerio


Alignment Length:241 Identity:64/241 - (26%)
Similarity:99/241 - (41%) Gaps:48/241 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 LREEQEEEEEADDQERDQQPLAN--QEDFDYDVQESL-----QSVESEQHDQYYGNIFHRDPSEN 218
            :.|..||..|...:|..::|:..  :|..|..|:|.:     :|||....:...      :|.|.
Zfish    89 VEEPVEEPVEEPVEELVEEPVEELVEELVDEPVEEPVVEPVEESVEKPVVEPVV------EPVEE 147

  Fly   219 EVD--NDCPN------CVDESQYTPN---KWTMPLLKLGEKR-------YYLGIFF--KANWFKA 263
            .|:  ::.|.      .|:||:...|   |..|.|.| |.:|       :....||  |.|...|
Zfish   148 PVEFQSEEPTLQADYIVVEESEVDMNPGRKQRMALQK-GRRRCRGFTVQHTCYEFFTRKLNASDA 211

  Fly   264 TQYCRY---HGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFT 325
            ...|:.   :| ||||::|......: .::.|........|:.|..:.....|.|: .|.|.|:.
Zfish   212 ELQCQKGCPNG-HLASVTSSFIRAEI-YNLMDRYSSRSDTWLGGRRIIGTNTFTWL-DGEPWTYN 273

  Fly   326 NWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVC 371
            .:.:|||||.    |..|:|:|:..|.|    :||..|.....|||
Zfish   274 GFFSGEPNNL----GGNEDCIEILYRVG----FNDVACFLTRPFVC 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 38/135 (28%)
si:ch211-160b11.4XP_021327879.1 CLECT 198..311 CDD:153057 35/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.