DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and illr2

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001121843.1 Gene:illr2 / 100147856 ZFINID:ZDB-GENE-050311-3 Length:253 Species:Danio rerio


Alignment Length:218 Identity:57/218 - (26%)
Similarity:82/218 - (37%) Gaps:42/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 REEQEEEEEADDQERDQQPLANQEDFDYDVQESLQSVESEQHDQYYGNIFHRDPSENEVDNDCPN 226
            |.|........|||.:..        ||..|..:..::.::..|....:       || .:.|..
Zfish    65 RTETHFNVSVSDQEHNAT--------DYKEQLDVLHIQHQEMLQKLNRL-------NE-SSGCAL 113

  Fly   227 CVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIR 291
            |...       ||    ..|.|.||... .|.||.::..:|...|.||..|:|:.|.|.|...| 
Zfish   114 CAVH-------WT----HSGGKCYYFST-VKMNWTQSRDHCVTKGGHLVIITSKAEQDFLASKI- 165

  Fly   292 DFGLGHEHFWISGTDLADEGNFFWM---ATGRPITF----TNWNAGEPNNFRYENGEEENCLELW 349
              .:.|   ||...|:..||.:.|:   ...:.:.|    .|.| .||:|:...:...|:|..|.
Zfish   166 --SVTH---WIGLNDMHTEGRWVWVDNQPLNKSVEFWMKRVNGN-NEPDNWTKNHPGGEDCACLG 224

  Fly   350 NRDGKGLKWNDSPCSFETYFVCE 372
            :..|....|||..|:....||||
Zfish   225 HSLGATEFWNDDLCTATKRFVCE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 40/131 (31%)
illr2NP_001121843.1 CLECT_DC-SIGN_like 114..247 CDD:153060 43/151 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.