DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and hbl4

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001108197.1 Gene:hbl4 / 100137128 ZFINID:ZDB-GENE-070912-287 Length:245 Species:Danio rerio


Alignment Length:130 Identity:40/130 - (30%)
Similarity:68/130 - (52%) Gaps:12/130 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 KLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLA 308
            |:|:| ||:......|:..|.::|...|..:....|::||..|.. ::: .|...:..:..||..
Zfish   128 KVGQK-YYVSDGLVGNFETAQKFCSDAGAKIVLPRSEDENKVLIS-LQE-ALESTYVHVGATDAK 189

  Fly   309 DEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCEV 373
            .||:|..: :.:|:|||||...|||::   ||.|: |..::    |...|||..|:.:.:.|||:
Zfish   190 KEGHFVDL-SDQPLTFTNWKEKEPNDY---NGAED-CTAVY----KTGVWNDINCNSKWHVVCEL 245

  Fly   374  373
            Zfish   246  245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 36/123 (29%)
hbl4NP_001108197.1 Collagen 33..>92 CDD:189968
CLECT_collectin_like 131..245 CDD:153061 37/125 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.