DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and si:dkey-241l7.4

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001096098.2 Gene:si:dkey-241l7.4 / 100124601 ZFINID:ZDB-GENE-041014-238 Length:153 Species:Danio rerio


Alignment Length:122 Identity:43/122 - (35%)
Similarity:58/122 - (47%) Gaps:21/122 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 FF--KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMA 317
            ||  ..||..|.:.|:..|.:|||:..|.|||.|...:.    |....||.|.|...:|.:.| :
Zfish    41 FFSRSVNWVTAERNCQSLGGNLASVHDQVENDFLLSLVP----GSTRCWIGGHDGEQDGQWLW-S 100

  Fly   318 TGRPITFTNWNAGEPNNFRYENGEEENCLEL-W--NRDGKGLKWNDSPCSFETYFVC 371
            .|....:|||.:|||      :|..|:|||: |  ||     .|||..||....::|
Zfish   101 DGSVYGYTNWCSGEP------SGGSEHCLEINWTSNR-----CWNDQRCSTRMGYLC 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 43/122 (35%)
si:dkey-241l7.4NP_001096098.2 CLECT 27..146 CDD:214480 42/120 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BFQ9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.