DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and mbl2

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_571645.2 Gene:mbl2 / 100008009 ZFINID:ZDB-GENE-000427-2 Length:251 Species:Danio rerio


Alignment Length:132 Identity:38/132 - (28%)
Similarity:63/132 - (47%) Gaps:15/132 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 KLGEKRYYLGIFFKANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLA 308
            |:|:| ||:....:..:.|..|||..:|..|....:.|||..|:..:..   ..:..:|..||..
Zfish   132 KVGQK-YYVTDDVEETFDKGMQYCSSNGGALVLPRTLEENALLKVFVSS---AFKRLFIRITDRE 192

  Fly   309 DEGNFFWMATGR-PITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVCE 372
            .||.|  :.|.| .:|||||...:|:|::    ..::|..:.:   .|| |:|..|......:||
Zfish   193 KEGEF--VDTDRKKLTFTNWGPNQPDNYK----GAQDCGAIAD---SGL-WDDVSCDSLYPIICE 247

  Fly   373 VQ 374
            ::
Zfish   248 IE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 34/124 (27%)
mbl2NP_571645.2 CLECT_collectin_like 135..248 CDD:153061 35/126 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.