DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and si:dkey-81n2.2

DIOPT Version :10

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_009301132.1 Gene:si:dkey-81n2.2 / 100001804 ZFINID:ZDB-GENE-070705-493 Length:367 Species:Danio rerio


Alignment Length:143 Identity:38/143 - (26%)
Similarity:61/143 - (42%) Gaps:34/143 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 PLLKLG--------EKRYYLGIFFKAN--WFKATQYCRYHGMHLASISSQEENDRLEKHIR--DF 293
            |||.:.        :::|:   |...|  |..|.:|||.....||::.:..:..:|.|.::  |.
Zfish     8 PLLLIAVCSISECVQRQYH---FINENKTWTDAQRYCREKYTDLATVDNMNDMIQLNKSVKVNDK 69

  Fly   294 GLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEENCLELWNRDGKGLKW 358
            |:     || |.......|:.| ::|.|:.|.||.:|:|    |..   .||..:     |..||
Zfish    70 GV-----WI-GLQGTRAYNWHW-SSGDPVLFLNWASGQP----YSG---NNCTVI-----KNGKW 115

  Fly   359 NDSPCSFETYFVC 371
            ....|:....|:|
Zfish   116 FVGACNATWTFIC 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 35/127 (28%)
si:dkey-81n2.2XP_009301132.1 CLECT_1 23..130 CDD:153072 35/128 (27%)
CLECT_1 133..246 CDD:153072
CLECT 252..364 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.