DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tfc and si:dkey-28d5.7

DIOPT Version :9

Sequence 1:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_021333340.1 Gene:si:dkey-28d5.7 / 100000161 ZFINID:ZDB-GENE-060503-259 Length:360 Species:Danio rerio


Alignment Length:182 Identity:41/182 - (22%)
Similarity:63/182 - (34%) Gaps:70/182 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 FHRDPSENEVDNDCPN----------CVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQ 265
            |:|:|.:.. :|:|..          |.|...:.....:..|:.:.:         ..||..|..
Zfish    92 FNRNPGQYS-NNNCGKIKHGQWFAEACSDTHLFICYNMSRGLVFVNQ---------TMNWRDAQS 146

  Fly   266 YCRYHGMHLASISSQEENDRLEKHIRD---FGLGHEHFWISGTDLADEGNFF--WMATGRPITFT 325
            |||.:.:.|.|:.:|.|:..|||.|.|   ||   ...||        |.|.  |          
Zfish   147 YCRQNHIDLVSVRNQNESQELEKFINDTISFG---SEVWI--------GLFRDPW---------- 190

  Fly   326 NWNAGEPNNFRYENGEEENCLELWNRDGKGLKWNDSPCSFETYFVC-EVQPN 376
            .|:....::|||                    |.|   :|:.:..| .:|||
Zfish   191 QWSDQSNSSFRY--------------------WAD---NFKDFAYCAAIQPN 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tfcNP_612091.1 CLECT 249..373 CDD:153057 30/129 (23%)
si:dkey-28d5.7XP_021333340.1 CLECT 23..127 CDD:321932 7/35 (20%)
CLECT 130..239 CDD:321932 34/143 (24%)
CLECT 245..357 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.