DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9129 and CG9133

DIOPT Version :9

Sequence 1:NP_612088.2 Gene:CG9129 / 38138 FlyBaseID:FBgn0035196 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001027093.1 Gene:CG9133 / 3772453 FlyBaseID:FBgn0035198 Length:332 Species:Drosophila melanogaster


Alignment Length:214 Identity:37/214 - (17%)
Similarity:66/214 - (30%) Gaps:87/214 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SCVNPCSPKCGKC--------------------------TLFTLESPITDEDVM----------- 89
            :|...|||:...|                          |:..|::....|.||           
  Fly    45 ACDCDCSPELAPCFIQPTKPDPGPEAYDEFEACLNGSGLTIRVLKNTHKVESVMDGSETAPNLGA 109

  Fly    90 -HIHVYKKRTESCKFLLGLTELPMKP--IFDRVKKEFYSQNINWESNVESHLSR----------- 140
             ....|:.....|:        |.|.  :.|.:::..:::|         |:.|           
  Fly   110 GDDPCYRDDPNDCE--------PAKESCLHDMLQRSSFARN---------HIKRRTGGRIINHPN 157

  Fly   141 MPKLRGPCKKANDCVCYERNRERREQWCPTSELTKRMLPLFNLCKMQTGNIVLILRLVCNG--PS 203
            :||:|...|.:.:..|     |....:.|.|::.:       .|..|...:....:.:|.|  |.
  Fly   158 IPKVRANIKYSGNDAC-----ETDNYYVPFSKIKE-------ACDFQEAKVDCYRQRLCGGSDPI 210

  Fly   204 VVSSFPVQRPVCKDPCNCC 222
            |.:..|||     :..:||
  Fly   211 VPAHCPVQ-----NQRSCC 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9129NP_612088.2 DUF4497 70..205 CDD:291585 27/187 (14%)
CG9133NP_001027093.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C8Z4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.