DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9129 and CG9130

DIOPT Version :9

Sequence 1:NP_612088.2 Gene:CG9129 / 38138 FlyBaseID:FBgn0035196 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001027095.1 Gene:CG9130 / 3772105 FlyBaseID:FBgn0035197 Length:517 Species:Drosophila melanogaster


Alignment Length:268 Identity:165/268 - (61%)
Similarity:202/268 - (75%) Gaps:26/268 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RMDKSEKRSNLADNFLYMLEFMVDDLLITRPNLCAPEEYPTCTEITFR-SVFLNIRDRENGSCVN 65
            :.:|.||...:|.|||||.||:||||||||.||||||||||||||||| ||::|:.|||.|:|||
  Fly    15 KSEKPEKPPKIAGNFLYMFEFVVDDLLITRQNLCAPEEYPTCTEITFRSSVYVNLCDREVGTCVN 79

  Fly    66 PCSPKCGKCTLFTLESPITDEDVMHIHVYKKRTESCKFLLGLTELPMKPIFDRVKKEFYSQNINW 130
            |||||||||.||||:|||||:||:.:|||||||||||||:||:||.:||||||||:.|..:|.:|
  Fly    80 PCSPKCGKCALFTLDSPITDKDVLQVHVYKKRTESCKFLIGLSELKVKPIFDRVKESFDIENPDW 144

  Fly   131 ESNVESHLSRMPKLRGPCKKA--NDCVCYERNRERREQWCPTSELTKRMLPLFNLCKMQTGNIVL 193
            |..:..|::::||::||..|.  ::|.|||:..||.|||||||||:||:||||||||||||||||
  Fly   145 EDAMLGHIAQLPKMKGPTSKGLLDNCACYEKLNERHEQWCPTSELSKRLLPLFNLCKMQTGNIVL 209

  Fly   194 ILRLVCNGPSVVSSFPVQR-----PVCKDPC-----------------NC-CCPCPPTWPAPCSS 235
            |||||||||::||:||..:     |.|.:||                 :| .||.||:...||..
  Fly   210 ILRLVCNGPTIVSTFPFSKVCSRNPKCPEPCCGPCGPCGPCGPCPPPPSCGSCPPPPSCGPPCPP 274

  Fly   236 PFDPCDPC 243
            |.||||||
  Fly   275 PCDPCDPC 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9129NP_612088.2 DUF4497 70..205 CDD:291585 93/136 (68%)
CG9130NP_001027095.1 DUF4497 84..221 CDD:291585 93/136 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454067
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C8Z4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019742
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.