DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sac1 and SYNJ1

DIOPT Version :9

Sequence 1:NP_001189016.1 Gene:Sac1 / 38137 FlyBaseID:FBgn0283500 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_003886.3 Gene:SYNJ1 / 8867 HGNCID:11503 Length:1612 Species:Homo sapiens


Alignment Length:550 Identity:156/550 - (28%)
Similarity:252/550 - (45%) Gaps:96/550 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SREENAVYDDMNLYIA------------PQSFIIEPNGGDELLVIGRHDKVTRVQPASGGLVANL 55
            ||.:.|..::..:..:            |.|.|:|....:|.|:.            ..|.||.|
Human    28 SRRKRAASEERRMAFSKGFRIYHKLDPPPFSLIVETRHKEECLMF------------ESGAVAVL 80

  Fly    56 RPTRR------------ICGVLGTIHLLSCD----YLLVATHRLFVGVLNGAVVWRLAGYDIIPY 104
            ....:            ..|:||.:.|...|    ||::.|..:.||.:..:.|:|:...:.|..
Human    81 SSAEKEAIKGTYSKVLDAYGLLGVLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISL 145

  Fly   105 IPNSFQRKENENYLRLLRQTLDTKFFYFSYR---YDLTNSLQRQREVAQSRPEVSGLLQRAEQRF 166
            ..:|    .:|:.:..:|:.|::..|||::.   ..|..||...|.:.:         |..:.||
Human   146 RIDS----SDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQE---------QTTDNRF 197

  Fly   167 VWNGYV---LRQF--NCDKMEKFQLPLVLGFVSINQVQINGQTFFWSIITRRSVQRAGTRLFCRG 226
            .||..:   |:.:  |||   .:.|.|:.|.|.|..:....:.....:|:|.|.:|||||...||
Human   198 FWNQSLHLHLKHYGVNCD---DWLLRLMCGGVEIRTIYAAHKQAKACLISRLSCERAGTRFNVRG 259

  Fly   227 SDEQGHVANFVETEQIVEFNGQLTGFVQTRGSMPFHWHQLPNLRYKPRPVLV--------PGKDH 283
            :::.|||||||||||:|..:..::.|:|.|||:|..|.| |.|:.....|.:        |..|.
Human   260 TNDDGHVANFVETEQVVYLDDSVSSFIQIRGSVPLFWEQ-PGLQVGSHRVRMSRGFEANAPAFDR 323

  Fly   284 LAACGLHFKEQIRLYGNNVAVNLVDHKGAEGEL-EATYARLVREMGNPQVRYESFDFHSECRKMR 347
                  ||:....|||..:.|||:..|..|..| :|..:.|........::..:||:|...:..:
Human   324 ------HFRTLKNLYGKQIIVNLLGSKEGEHMLSKAFQSHLKASEHAADIQMVNFDYHQMVKGGK 382

  Fly   348 WDRLNILIDRLAHEQDQFGVYHVFDDGKLVSTQTGVFRTNCIDCLDRTNVVQSMLARRSLTAVLQ 412
            .::|:.::.....:...:|.:: |:..::...|:|..||||:|||||||.||:.|....|...|:
Human   383 AEKLHSVLKPQVQKFLDYGFFY-FNGSEVQRCQSGTVRTNCLDCLDRTNSVQAFLGLEMLAKQLE 446

  Fly   413 KLGVLHVGQKVEHASDIFESIFKGVWADNADLVSLQYSGTCALKTDFTRTGKRTKSGAMQDGKNS 477
            .||:....|.|..    |:.:|:.:|:.|.|.:|..|:||.||:      ||    ..::||..|
Human   447 ALGLAEKPQLVTR----FQEVFRSMWSVNGDSISKIYAGTGALE------GK----AKLKDGARS 497

  Fly   478 LMRYYLNNFADGQRQDSID-LFLGKYLVND 506
            :.|...|||.|..:|::|| |.||..|.:|
Human   498 VTRTIQNNFFDSSKQEAIDVLLLGNTLNSD 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sac1NP_001189016.1 COG5329 3..566 CDD:227637 155/549 (28%)
Syja_N 62..344 CDD:280532 89/302 (29%)
SYNJ1NP_003886.3 Syja_N 99..379 CDD:280532 89/302 (29%)
INPP5c_Synj1 572..907 CDD:197332
DUF1866 906..1047 CDD:286093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.