DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sac1 and CG6805

DIOPT Version :9

Sequence 1:NP_001189016.1 Gene:Sac1 / 38137 FlyBaseID:FBgn0283500 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_611178.1 Gene:CG6805 / 36911 FlyBaseID:FBgn0034179 Length:357 Species:Drosophila melanogaster


Alignment Length:238 Identity:55/238 - (23%)
Similarity:85/238 - (35%) Gaps:82/238 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 VLRQFNCDKMEKFQLPLVL---------GFVSINQVQINGQTFFWSIITRRSVQRAGTRLFCRGS 227
            ||:.||.|       |.||         .||.::..|:.|     .:||          :|.   
  Fly    63 VLKIFNDD-------PWVLKIADSLSDHQFVKVDSKQLQG-----ILIT----------MFA--- 102

  Fly   228 DEQGHVANFVETEQIVEFNGQLTGFVQTRGSMPFHWHQLPNLR---YKPRPVLVPGKDHLAACGL 289
             :..|:.:..|.|......| |.|....:|::        ::|   |......|  ..||||...
  Fly   103 -QHKHIPHMKEIETEATRTG-LGGLWGNKGAV--------SIRLSLYGTGVAFV--CSHLAAHDE 155

  Fly   290 HFKEQIRLYGNNVAVNLVD-HK-GAEGELEATYARL-----VREMGNPQVR----YESFDFHSEC 343
            ..||:|..|.     .:|| || .|:|     |.|:     |...|:...|    ..::|..::.
  Fly   156 KLKERIEDYH-----QIVDNHKYNAQG-----YRRIFDHDFVFWFGDLNFRLSGDMSAWDVRTDV 210

  Fly   344 RKMRW------DRLNILIDR------LAHEQDQFGVYHVFDDG 374
            ...|:      |:||:|.::      |..:|..|.....|.:|
  Fly   211 ENQRYADLLKLDQLNLLREKGNAFSLLEEQQPNFAPTFKFVEG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sac1NP_001189016.1 COG5329 3..566 CDD:227637 55/238 (23%)
Syja_N 62..344 CDD:280532 45/194 (23%)
CG6805NP_611178.1 EEP 12..308 CDD:294334 55/238 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447405
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.