DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sac1 and CG9784

DIOPT Version :9

Sequence 1:NP_001189016.1 Gene:Sac1 / 38137 FlyBaseID:FBgn0283500 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster


Alignment Length:400 Identity:78/400 - (19%)
Similarity:126/400 - (31%) Gaps:133/400 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YDDMNLYIAPQSFIIEPNGGDELLVIGRHDKVTRVQPAS--------GGLVAN-----LRPTRRI 61
            ||    |:|.::   |...|..|.:..|...|..:|...        ||:..|     :|.|...
  Fly   111 YD----YVAVKT---EQMQGLLLSMFVRRQHVEHLQDIEAEFTRTGFGGIWGNKGAVSVRFTLYG 168

  Fly    62 CGVLGTI-HLLSCDYLLVATHRLFVGVLNGAVVWRLAGYDIIPYIPNSFQRKENENY-LRLLRQT 124
            ||:...: ||.:.|:::..               |:..|.         |..||.:| ::..|:.
  Fly   169 CGLAFVVAHLTAHDHMMDE---------------RIEDYK---------QILENHHYHVKRYREI 209

  Fly   125 LDTKF-FYF---SYRYDLTNSLQRQREVAQSRPEVSGLLQRAEQRFVWNGYVLRQFNCDKMEKFQ 185
            .|..: |:|   ::|...::|....||:.:...:...|:||.:.      |.:|       ||.|
  Fly   210 YDHDYVFWFGDLNFRLQGSDSSTEVRELVRDESQHEALIQRDQL------YQVR-------EKSQ 261

  Fly   186 LPLVLGFVSINQVQINGQTFFWSIITRRSVQRAGTRLFCRGSDEQGHVANFVETEQIVEFNGQLT 250
            |.                   :.::..|......|..|..|:.|.........|::|:.      
  Fly   262 LA-------------------FQVLQERLPAFPPTFKFREGTSEYDLKRRPAWTDRIMY------ 301

  Fly   251 GFVQTRGSMPFHWHQLPNLRYKPRPVLVPGKDHLAACGLHFKEQIRLYGNNVAVNLV-------- 307
             .||.....|.....:....||..| |....||.....   ...|:||.|..|..:|        
  Fly   302 -AVQPLNRQPGMQLSIEQCSYKSHP-LYTISDHKPVTS---DFTIKLYPNVRAPGVVFSPLSLWK 361

  Fly   308 --------DHKGAE---------GELEATYARLVREMGNPQVRYESFDFHSECRKMRWDRLNILI 355
                    .||.||         |...:.||.|        ..|.::::.::.........|   
  Fly   362 IGDENTVEYHKQAEFDEGSNDWIGIFPSEYASL--------ADYVAYEYVNQAESPSSSDSN--- 415

  Fly   356 DRLAHEQDQF 365
                |:.|.|
  Fly   416 ----HQPDPF 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sac1NP_001189016.1 COG5329 3..566 CDD:227637 77/399 (19%)
Syja_N 62..344 CDD:280532 59/312 (19%)
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 59/303 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.