DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sac1 and Ocrl

DIOPT Version :9

Sequence 1:NP_001189016.1 Gene:Sac1 / 38137 FlyBaseID:FBgn0283500 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001259153.1 Gene:Ocrl / 31157 FlyBaseID:FBgn0023508 Length:850 Species:Drosophila melanogaster


Alignment Length:413 Identity:76/413 - (18%)
Similarity:133/413 - (32%) Gaps:128/413 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 GSDEQGHVANFVETEQIVEFNGQLTGFVQTRGSMPFHWHQLPNLRYKPRPVLVPGKDHL------ 284
            |....|.:::....|.::::: ||.  .:.|....|..:....::::|.....||.|:.      
  Fly   376 GQQRPGPLSDAQTYELLLQYD-QLR--QEMRRGKCFEGYTEGEIKFRPTYKYDPGTDNYDSSEKQ 437

  Fly   285 ---AACGLHFKEQIRL----YGNNVAVNLVDHKGAEGEL--------EATYARLVREM------- 327
               |.|.....:..|:    |.:.:.:...|||......        |..|.|:..|:       
  Fly   438 RAPAYCDRVLWKGTRIEQLAYNSIMEIRQSDHKPVYAVFQVKVKTRDEVKYKRVQEEVLKAVDKR 502

  Fly   328 ---GNPQVRYE-----------------SFDFHSECRKMRWDRLNILIDRLAHEQDQFGV----Y 368
               ..||:..|                 .|:.::.|        .:.:|....|:|...:    .
  Fly   503 ENDNQPQINVEKTVIDFGTVRFNEPSTRDFNVYNNC--------PLPVDFSFKEKDIHAICEPWL 559

  Fly   369 HV--FDDGKLVSTQTGV-FRTNCIDCLDRTNVVQSMLARRSLTAVLQKLG--------VLHVGQK 422
            ||  ..|..|:.:...: .:.|       .||       |::..:|:|:.        :||    
  Fly   560 HVDPRQDSLLIDSARSIRLKMN-------ANV-------RTIAGLLRKIRASDNFDILILH---- 606

  Fly   423 VEHASDIFESIFKGVWADNADLVSLQYSGTC---ALKTDFTRTGKRTKSGAMQDGKNSLMRYYLN 484
            ||:..|||.:            |:..|..:|   :::| ..|| .|..|...||....||.....
  Fly   607 VENGRDIFIT------------VTGDYQPSCFGLSMET-MCRT-DRPLSEYSQDQIKQLMNDESP 657

  Fly   485 NFADGQRQDSIDLFLGKYLVNDNEGGAVPSPLESK--------------HGWRFFTFPSVLLVAV 535
            .:.....::...|....|.....:.||.|| .:|:              ..|....||:....|.
  Fly   658 EYRVTMPREFFLLIDYLYRQGSKQVGAFPS-YDSRLSLGAQFNSVRDWLDTWSDDPFPANAETAA 721

  Fly   536 AMFMITMTYP----AEFNTENLL 554
            ...::.:..|    .|...||||
  Fly   722 QALLLLLDLPEHALLEPVVENLL 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sac1NP_001189016.1 COG5329 3..566 CDD:227637 76/413 (18%)
Syja_N 62..344 CDD:280532 26/165 (16%)
OcrlNP_001259153.1 PH-like 23..163 CDD:302622
INPP5c_INPP5B 185..478 CDD:197327 18/104 (17%)
RhoGAP_OCRL1 614..823 CDD:239845 30/146 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447415
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.