DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sac1 and fig4b

DIOPT Version :9

Sequence 1:NP_001189016.1 Gene:Sac1 / 38137 FlyBaseID:FBgn0283500 Length:592 Species:Drosophila melanogaster
Sequence 2:XP_009302310.1 Gene:fig4b / 100329711 ZFINID:ZDB-GENE-141113-1 Length:299 Species:Danio rerio


Alignment Length:297 Identity:65/297 - (21%)
Similarity:116/297 - (39%) Gaps:91/297 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VYDDMNLYIAPQSFIIEPNGGDELLVIGRHDKVTRV---QPASGGLVANLRPTRRIC--GVLGTI 68
            :.||.::|  .|..:.|        ::||.|...|.   |..|.||      :|.:.  |::|.:
Zfish    50 IIDDKHVY--SQQEVRE--------LLGRLDLGNRTKMGQKGSSGL------SRAVSAYGIVGFV 98

  Fly    69 HLLSCDYLLVATHRLFVGVLNGAVVWRLAGYDIIPYIPNSFQR---KENENYLRLLRQTLDTKFF 130
            ..|...|:::.|.|..:..:.|..::::...::| ||||...|   .:...|:|:.:....:..|
Zfish    99 RFLEGYYIVLITKRRKMADIGGHSIYKIEDTNMI-YIPNDSVRVTHPDEARYVRIFQNVDLSSNF 162

  Fly   131 YFSYRYDLTNSLQRQREVAQS-------------RPE--------------VSGLLQRAEQRFVW 168
            ||||.||:::|||....:.||             |.:              |.||......::||
Zfish   163 YFSYSYDVSHSLQYNLTLLQSWSVCVESESGAAGRQDTFDIFEEEGLPTQVVHGLSHEPYSKYVW 227

  Fly   169 NGYVLRQFNCDKMEKFQLP-----LVLGFVSINQVQINGQTFFWSIITRRSVQRAGTRLFCRGSD 228
            |..:|     :|:::...|     ::.||.        ||:   ||:..              ||
Zfish   228 NLRLL-----EKVKEIVHPDWLLYIIHGFC--------GQS---SILLH--------------SD 262

  Fly   229 EQGHVANFVETEQIVEFNGQLTGFVQTRGSMPFHWHQ 265
            ...|...|:..    .|:.:::.|:|......:..|:
Zfish   263 SARHSCMFLHR----NFSKKVSIFMQNDSKSIYKSHK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sac1NP_001189016.1 COG5329 3..566 CDD:227637 65/297 (22%)
Syja_N 62..344 CDD:280532 51/241 (21%)
fig4bXP_009302310.1 Syja_N 92..>273 CDD:280532 47/211 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D359616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.