DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and KIF14

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_055690.1 Gene:KIF14 / 9928 HGNCID:19181 Length:1648 Species:Homo sapiens


Alignment Length:215 Identity:38/215 - (17%)
Similarity:78/215 - (36%) Gaps:50/215 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRQTKMFGEKAFDLL----KELERSS-----------QTIPAFDDDGVRQVLEEIKAIF----- 45
            |.:.:.::...|...|    |||..||           :||.   |..:...|:....:|     
Human  1223 MDKSSTIYSNSAESFLPGICKELIGSSLDFFGQSYDEERTIA---DSLINSFLKIYNGLFAISKA 1284

  Fly    46 -EENVAQASSYNASGDRSLWPLLNFRHAALQRNKRCLLAYLYE--RCRRIKALRWEFGPIIPGDI 107
             ||...::.....|.||::..|......|.::....:..:|.:  .|..|..|.        .::
Human  1285 HEEQDEESQDNLFSSDRAIQSLTIQTACAFEQLVVLMKHWLSDLLPCTNIARLE--------DEL 1341

  Fly   108 KQALCEPEVTFFNNYSKSLAAYMCSAGYNQGLPIDLTNNLRPPKSLYIEV--RCMEDYGKFELDD 170
            :|.:            |.|..|:  ..:.||..:|:::.::..:...|::  :.::..|:..:..
Human  1342 RQEV------------KKLGGYL--QLFLQGCCLDISSMIKEAQKNAIQIVQQAVKYVGQLAVLK 1392

  Fly   171 GEVIHLKKNSQHYLPRAQVE 190
            |..:|..:|..:.....|.|
Human  1393 GSKLHFLENGNNKAASVQEE 1412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 27/147 (18%)
GINS_B 153..201 CDD:425409 7/40 (18%)
KIF14NP_055690.1 Required for PRC1-binding 1..356
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Required for microtubule-binding with high affinity. /evidence=ECO:0000250|UniProtKB:L0N7N1 356..737
KISc_KIF1A_KIF1B 357..708 CDD:276816
KISc 358..708 CDD:214526
Kinesin_assoc 705..823 CDD:292801
FHA 803..900 CDD:238017
Required for CIT-binding 901..1648 38/215 (18%)
YlqD 962..>1022 CDD:287979
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1600..1648
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.