DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and PSF1

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001323116.1 Gene:PSF1 / 844359 AraportID:AT1G80190 Length:207 Species:Arabidopsis thaliana


Alignment Length:207 Identity:58/207 - (28%)
Similarity:100/207 - (48%) Gaps:36/207 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MFGEKAFDLLKELERSSQ-TIPAFDDDGVRQVLEE-----------IKAIFEENVAQASSYNASG 59
            |:|.|.:.|:|:.....: .:..|:.....:.:||           |:.:.:|.:...::.||..
plant     1 MYGRKGYQLIKDFATGEKGQLKPFNSKLFDETIEECDQNHHLIQSLIRKMQQEGLDVQNNRNADH 65

  Fly    60 DRSLWPLLNFRHAALQRNKRCLLAYLYERCRRIKALRWEFG---PIIPGDIKQALCEPEVTFFNN 121
            ..:|     ..|.||.||||||:||:|.|...::.|.|..|   ..:|.:|::.|...|..:|.|
plant    66 YGAL-----IHHLALIRNKRCLMAYVYNRAEIVRDLAWRVGLELLDLPSEIQEKLTTLEKEYFKN 125

  Fly   122 YSKSLAAYMCSAGYNQGLPIDLTNNLRPPKSLYIEVRCMEDYGKFELDDGEVI-----HLKKNSQ 181
            :|.:|.:||...|      |:|..::.|||..||:||.::|     :|:|.|:     :..::|.
plant   126 HSVALKSYMGKVG------IELNVDMVPPKDPYIKVRILDD-----IDEGIVLSDKTTNFARHSM 179

  Fly   182 HYLPRAQVESLV 193
            |:|.|...|..:
plant   180 HFLKRTDAEPYI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 38/139 (27%)
GINS_B 153..201 CDD:425409 13/46 (28%)
PSF1NP_001323116.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5230
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44516
Inparanoid 1 1.050 80 1.000 Inparanoid score I2375
OMA 1 1.010 - - QHG54100
OrthoDB 1 1.010 - - D1249159at2759
OrthoFinder 1 1.000 - - FOG0003503
OrthoInspector 1 1.000 - - otm3552
orthoMCL 1 0.900 - - OOG6_103148
Panther 1 1.100 - - LDO PTHR12914
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3957
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.