DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and AT1G55550

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_564696.2 Gene:AT1G55550 / 842004 AraportID:AT1G55550 Length:859 Species:Arabidopsis thaliana


Alignment Length:213 Identity:48/213 - (22%)
Similarity:70/213 - (32%) Gaps:69/213 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LKELERSSQTIPAFD-----DDGVRQVLEEIKAIFEENVAQASSYNASGDRSLWPLLNFRHAALQ 75
            |.|.:|.:..   ||     |.....|..||:.:.:..:   ..|||                  
plant   122 LSETKRKTYN---FDRVFQPDSSQDDVFLEIEPVIKSVI---DGYNA------------------ 162

  Fly    76 RNKRCLLAYLYERCRRIKALRWEFGPIIPGDIKQAL------CEPEVTFFNNYSKSLAAYMCSAG 134
                |:.|  |.:....|....|..|..||.:.:|:      .|.....|..:...|..||  ..
plant   163 ----CIFA--YGQTGTGKTYTMEGLPNSPGIVPRAIKGLFKQVEESNHMFTIHFSMLEIYM--GN 219

  Fly   135 YNQGLPIDLTNNLRP-PKSLYI------EVRCMEDYGKFELDD-GEVIHLKK------------- 178
            ....|..:.|..:.| |.||.|      |:. :|:..|.::|| .|::.|.|             
plant   220 LKDLLLSEATKPISPIPPSLSIHTDPNGEID-IENLVKLKVDDFNEILRLYKVGCRSRATASTNS 283

  Fly   179 NS----QHYLPRAQVESL 192
            ||    .|.:.|..|.||
plant   284 NSVSSRSHCMIRVSVTSL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 26/128 (20%)
GINS_B 153..201 CDD:425409 17/64 (27%)
AT1G55550NP_564696.2 Motor_domain 89..411 CDD:277568 48/213 (23%)
Kinesin 97..411 CDD:278646 48/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.