DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and HIK

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_173273.2 Gene:HIK / 838418 AraportID:AT1G18370 Length:974 Species:Arabidopsis thaliana


Alignment Length:88 Identity:19/88 - (21%)
Similarity:36/88 - (40%) Gaps:16/88 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RQTKMFGEKAFDLLKELERSSQTIPAF---DDDGVRQVLEEIKAIFEENVAQASSYNASGDRSLW 64
            ::|...||::.|:     .|.:..|.:   ....::::.:..:...||||....:|...      
plant   685 KETPQKGEESGDV-----SSREGTPGYRRSSSVNMKKMQQMFQNAAEENVRSIRAYVTE------ 738

  Fly    65 PLLNFRHAALQRNKRCLLAYLYE 87
              |..|.|.||..|:.|:..:.|
plant   739 --LKERVAKLQYQKQLLVCQVLE 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 18/82 (22%)
GINS_B 153..201 CDD:425409
HIKNP_173273.2 KISc_CENP_E 31..353 CDD:276825
Kinesin 37..353 CDD:278646
DUF3490 792..955 CDD:288820
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.