DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and AT2G37420

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001323679.1 Gene:AT2G37420 / 818318 AraportID:AT2G37420 Length:1039 Species:Arabidopsis thaliana


Alignment Length:223 Identity:48/223 - (21%)
Similarity:79/223 - (35%) Gaps:61/223 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LKELERSSQTIPAFD----DDGVRQVLEEIKAIFEENVAQASS-----YNASGDRSLWPLLNFR- 70
            ||||....|...:.|    :..:...:|.::.....:..:||:     :|...|:.....|..| 
plant   637 LKELSEMLQKKASSDLEKKNTSIVSQIEAVEKFLTTSATEASAVAQDIHNLLNDQKKLLALAARQ 701

  Fly    71 -HAALQRNKR----------CLLAYLY---------------ERCRRIKALRWEFGPIIPGDIKQ 109
             ...|.|:.|          .:.:.:|               |:.|::.|...:|......:.||
plant   702 QEQGLVRSMRSAQEISNSTSTIFSNIYNQAHDVVEAIRASQAEKSRQLDAFEMKFKEEAEREEKQ 766

  Fly   110 ALCEPEVTFFNNYSKSLAAYMCSAGYNQGLPIDLTNNLR-----PPKSLYIEVRCMEDY---GKF 166
            ||.:..:......||..|  |.|         |.::|:|     ..|.||.::..|:..   .|.
plant   767 ALNDISLILSKLTSKKTA--MIS---------DASSNIREHDIQEEKRLYEQMSGMQQVSIGAKE 820

  Fly   167 ELDDGEVIHLKKNSQHYLPR--AQVESL 192
            ||.|    :|||...|:...  |..||:
plant   821 ELCD----YLKKEKTHFTENTIASAESI 844

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 30/153 (20%)
GINS_B 153..201 CDD:425409 14/45 (31%)
AT2G37420NP_001323679.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.