DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and AT2G28620

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001323772.1 Gene:AT2G28620 / 817411 AraportID:AT2G28620 Length:1042 Species:Arabidopsis thaliana


Alignment Length:109 Identity:24/109 - (22%)
Similarity:44/109 - (40%) Gaps:20/109 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DLLKELERSSQTI-PAFDDDGV-----RQVLEEI-KAIFEENVAQASSYNASGDRSLWPLLNFRH 71
            ||..|:||..|.: .|.:.:|:     |...||. |....:.:.|......:.|:.:..|     
plant   410 DLYSEIERLKQEVYAAREKNGIYIPKERYTQEEAEKKAMADKIEQMEVEGEAKDKQIIDL----- 469

  Fly    72 AALQRNKRCLLAYLYERCRRIKALRWEFGPIIPGDIKQALCEPE 115
            ..|..:::.:.|.|.|:..:.:...:|        .:|||.:.|
plant   470 QELYNSEQLVTAGLREKLDKTEKKLYE--------TEQALLDLE 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 24/109 (22%)
GINS_B 153..201 CDD:425409
AT2G28620NP_001323772.1 KISc_BimC_Eg5 48..401 CDD:276815
Smc 385..>634 CDD:224117 24/109 (22%)
antiphage_ZorA_3 485..828 CDD:411477 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.