DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and Gins1

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_081290.1 Gene:Gins1 / 69270 MGIID:1916520 Length:196 Species:Mus musculus


Alignment Length:196 Identity:102/196 - (52%)
Similarity:148/196 - (75%) Gaps:3/196 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MFGEKAFDLLKELERSSQ-TIPAFDDDGVRQVLEEIKAIFEENVAQASSYNASGDRSLWPLLNFR 70
            ||.|||.:|::||.|:.: .:|||::||:||||||:||::|:|.:..:...::|...|.|.:.||
Mouse     1 MFCEKAMELVRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSAGRGDLIPTVKFR 65

  Fly    71 HAALQRNKRCLLAYLYERCRRIKALRWEFGPIIPGDIKQALCEPEVTFFNNYSKSLAAYMCSAGY 135
            |.||.||:||.:||||:|..||:|||||:|.::|..::..:...|..:||:|.||||.||.|.|.
Mouse    66 HCALLRNRRCTIAYLYDRLLRIRALRWEYGSVLPNSLRFHMSAEETEWFNHYKKSLATYMRSLGG 130

  Fly   136 NQGLPIDLTNNLRPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYLPRAQVESLVRQGILHH 200
            ::||  |:|.:::|||||||||||::|||:||:|||..:.|||||||:|||.:.|.|:|||:|.|
Mouse   131 DEGL--DITQDVKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEH 193

  Fly   201 I 201
            :
Mouse   194 V 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 59/125 (47%)
GINS_B 153..201 CDD:425409 31/47 (66%)
Gins1NP_081290.1 COG5230 1..191 CDD:227555 100/191 (52%)
GINS_A_psf1 3..130 CDD:212548 59/126 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850256
Domainoid 1 1.000 218 1.000 Domainoid score I2638
eggNOG 1 0.900 - - E1_COG5230
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44516
Inparanoid 1 1.050 219 1.000 Inparanoid score I3565
Isobase 1 0.950 - 0 Normalized mean entropy S4395
OMA 1 1.010 - - QHG54100
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003503
OrthoInspector 1 1.000 - - oto92055
orthoMCL 1 0.900 - - OOG6_103148
Panther 1 1.100 - - LDO PTHR12914
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1017
SonicParanoid 1 1.000 - - X3957
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.