DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and kif14

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_005170522.1 Gene:kif14 / 562052 ZFINID:ZDB-GENE-030131-5759 Length:1506 Species:Danio rerio


Alignment Length:189 Identity:35/189 - (18%)
Similarity:64/189 - (33%) Gaps:51/189 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KAFDLLKELERSSQTIPAFDDDGVRQ---VLEEIKAIFE-------ENVAQASSYNASGDRSLWP 65
            :.|...:::|::.|.|...:.|.:.|   ..:..|..|:       |..|..||.....::...|
Zfish   243 RPFSSREKIEKACQVIFMENQDTLVQHPDTKQTHKFTFDFSFCSINEADASFSSQQLIYEKLARP 307

  Fly    66 LLNFRHAALQRNKRCLLAY--------------------LYERCRRIKALRWEFGPIIPGDIKQA 110
            ||   ..|.:....||.||                    :...|..:      |..:...:.|:.
Zfish   308 LL---ERAFEGFNTCLFAYGQTGSGKSYTMMGFGEETGVIPRFCEEL------FSRLARSETKEM 363

  Fly   111 LCEPEVTFFNNYSKSLAAYMCSAGYNQGLPIDLTNNLRPPKSLYIEVRCMEDYGKFELD 169
            .|..|:::|..|::.:...:.:.        |..|..:.|    :.||....||.:..|
Zfish   364 SCHLEMSYFEVYNEKIHDLLVAK--------DEQNQKKMP----LRVREHPVYGPYVAD 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 27/152 (18%)
GINS_B 153..201 CDD:425409 5/17 (29%)
kif14XP_005170522.1 KISc 235..586 CDD:214526 35/189 (19%)
KISc_KIF1A_KIF1B 236..586 CDD:276816 35/189 (19%)
Kinesin_assoc 583..701 CDD:292801
FHA 681..778 CDD:238017
Prefoldin 806..878 CDD:298833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.