DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and KIF27

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_011517150.1 Gene:KIF27 / 55582 HGNCID:18632 Length:1427 Species:Homo sapiens


Alignment Length:145 Identity:27/145 - (18%)
Similarity:54/145 - (37%) Gaps:25/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GDRSLWPLLNFRHAALQRNKRCLLAYLYERCRRIKALRWEFGPIIPGDIKQALCEPEVTFFNNYS 123
            |..:|...:.:|:.::|..::.|.|..:...|....:..:...:.|.:|:..|    ..:||...
Human  1087 GIEALEAAIEYRNESIQNRQKSLRASFHNLSRGEANVLEKLACLSPVEIRTIL----FRYFNKVV 1147

  Fly   124 KSLAAYMCSAGYNQGLP---IDLTNNLRPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYLP 185
            ....|......||:.:.   ::..|.:|       |:....|:.|.:.|....:..|::.|.   
Human  1148 NLREAERKQQLYNEEMKMKVLERDNMVR-------ELESALDHLKLQCDRRLTLQQKEHEQK--- 1202

  Fly   186 RAQVESLVRQGILHH 200
                    .|.:|||
Human  1203 --------MQLLLHH 1209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 13/74 (18%)
GINS_B 153..201 CDD:425409 10/48 (21%)
KIF27XP_011517150.1 KISc_KIF4 4..342 CDD:276823
KISc 5..348 CDD:214526
COG1340 820..1077 CDD:224259
DUF4200 826..>910 CDD:290574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.