DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and kif3cb

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001017849.2 Gene:kif3cb / 550547 ZFINID:ZDB-GENE-080709-4 Length:759 Species:Danio rerio


Alignment Length:90 Identity:20/90 - (22%)
Similarity:36/90 - (40%) Gaps:16/90 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PLLNFRHAALQRNKRCLLAYLYE----------RCRRIKALRWEFGP--IIPGDIKQALCEPE-- 115
            ||:..|..::..|||.:..|...          |...|..|..:..|  ::|.|::::....:  
Zfish   637 PLVRRRPTSVVGNKRPVSMYAQTAVAHGSPSRYRAENIMLLELDVSPPTMVPLDLQRSDIRTQDL 701

  Fly   116 VTFFNNYSKSLAA--YMCSAGYNQG 138
            :..|.:|.|...|  .|.:..:.||
Zfish   702 IRDFGHYRKRTTASRVMKARSWYQG 726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 18/84 (21%)
GINS_B 153..201 CDD:425409
kif3cbNP_001017849.2 KISc_KIF3 20..351 CDD:276822
KISc 21..358 CDD:214526
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.