Sequence 1: | NP_612086.1 | Gene: | Psf1 / 38136 | FlyBaseID: | FBgn0035194 | Length: | 202 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017604.2 | Gene: | kif3a / 550267 | ZFINID: | ZDB-GENE-050417-71 | Length: | 701 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 45/196 - (22%) |
---|---|---|---|
Similarity: | 72/196 - (36%) | Gaps: | 46/196 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 EKAFDLLKELERSSQTIPAFDDDGVRQVLEEIKAIFEENVAQASSYNASGDRSLWPLL---NFRH 71
Fly 72 AALQRNKRCLLAYLYERCRRI-KALRWEFGPIIPGDIKQALCEPEVTFFNNY---SKSLAAYMCS 132
Fly 133 AGYNQGLPIDLTNNLRPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYLPRAQVESLVRQGI 197
Fly 198 L 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Psf1 | NP_612086.1 | GINS_A_psf1 | 9..134 | CDD:212548 | 29/130 (22%) |
GINS_B | 153..201 | CDD:425409 | 11/46 (24%) | ||
kif3a | NP_001017604.2 | KISc_KIF3 | 16..348 | CDD:276822 | |
Kinesin | 23..348 | CDD:278646 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |