DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and kif3a

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001017604.2 Gene:kif3a / 550267 ZFINID:ZDB-GENE-050417-71 Length:701 Species:Danio rerio


Alignment Length:196 Identity:45/196 - (22%)
Similarity:72/196 - (36%) Gaps:46/196 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EKAFDLLKELERSSQTIPAFDDDGVRQVLEEIKAIFEENVAQASSYNASGDRSLWPLL---NFRH 71
            ::|..|.:|||...|.         |..:||.....:|. ||..:...   :.:|.:|   ....
Zfish   510 KRAEQLRRELEEKEQE---------RLDIEEKYTSLQEE-AQGKTKKL---KKVWTMLMAAKSEM 561

  Fly    72 AALQRNKRCLLAYLYERCRRI-KALRWEFGPIIPGDIKQALCEPEVTFFNNY---SKSLAAYMCS 132
            |.||:.....:..|.|..|:: :.||.:. .||...|.|...|    ...||   ::.:..:...
Zfish   562 ADLQQEHHREIEGLLENIRQLSRELRLQM-LIIDNFIPQEYQE----MIENYVHWNEDIGEWQLK 621

  Fly   133 AGYNQGLPIDLTNNLRPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYLPRAQVESLVRQGI 197
            .....|      ||:|  |...:..:..:|  .||:|...|         ||  |..|..:||.:
Zfish   622 CVAYTG------NNMR--KQTPVSDKKEKD--PFEVDLSHV---------YL--AYTEESMRQSL 665

  Fly   198 L 198
            :
Zfish   666 M 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 29/130 (22%)
GINS_B 153..201 CDD:425409 11/46 (24%)
kif3aNP_001017604.2 KISc_KIF3 16..348 CDD:276822
Kinesin 23..348 CDD:278646
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.