DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and gins1

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001016164.1 Gene:gins1 / 548918 XenbaseID:XB-GENE-5842214 Length:196 Species:Xenopus tropicalis


Alignment Length:196 Identity:103/196 - (52%)
Similarity:145/196 - (73%) Gaps:3/196 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MFGEKAFDLLKELERSSQ-TIPAFDDDGVRQVLEEIKAIFEENVAQASSYNASGDRSLWPLLNFR 70
            ||.|||.:|::||.|:|. .:|||::||:||||||:||::|:|.|..:...:.|...|.|.:.||
 Frog     1 MFCEKAIELIRELHRASDGQLPAFNEDGIRQVLEEMKALYEQNQADVNEAKSEGRSDLIPTIKFR 65

  Fly    71 HAALQRNKRCLLAYLYERCRRIKALRWEFGPIIPGDIKQALCEPEVTFFNNYSKSLAAYMCSAGY 135
            |..|.||:||::||||:|..||:|||||:|.::|..::..:...|:.:||.|.:|||.||.|.|.
 Frog    66 HCCLLRNRRCIVAYLYDRLLRIRALRWEYGSVLPNALRFHMSAEEMDWFNQYKRSLATYMRSLGG 130

  Fly   136 NQGLPIDLTNNLRPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYLPRAQVESLVRQGILHH 200
            .:||  |:|.:::|||||||||||:.|||:||:|||..|.|||||||:|||.:.|.|:|||:|.|
 Frog   131 EEGL--DITQDMKPPKSLYIEVRCLRDYGEFEIDDGTTILLKKNSQHFLPRWKCEQLIRQGVLEH 193

  Fly   201 I 201
            :
 Frog   194 V 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 59/125 (47%)
GINS_B 153..201 CDD:425409 32/47 (68%)
gins1NP_001016164.1 GINS_A_psf1 3..130 CDD:212548 59/126 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44516
Inparanoid 1 1.050 221 1.000 Inparanoid score I3454
OMA 1 1.010 - - QHG54100
OrthoDB 1 1.010 - - D1249159at2759
OrthoFinder 1 1.000 - - FOG0003503
OrthoInspector 1 1.000 - - oto102362
Panther 1 1.100 - - LDO PTHR12914
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1017
SonicParanoid 1 1.000 - - X3957
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.