DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and kif11

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001016116.2 Gene:kif11 / 548870 XenbaseID:XB-GENE-978999 Length:1067 Species:Xenopus tropicalis


Alignment Length:74 Identity:18/74 - (24%)
Similarity:31/74 - (41%) Gaps:17/74 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KMFGEKAFDLLKELERSSQTIPAFDD---------DGVRQV----LEEIKAIFEENVAQ----AS 53
            :::.|:.||||.......:.:..|||         .|:.:|    .:|:..|.|...|:    ::
 Frog   162 EIYNEELFDLLSPSPDVGERLQMFDDPRNKRGVIIKGLEEVSVHNKDEVYHILERGAARRKTAST 226

  Fly    54 SYNASGDRS 62
            ..||...||
 Frog   227 LMNAYSSRS 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 18/71 (25%)
GINS_B 153..201 CDD:425409
kif11NP_001016116.2 KISc_BimC_Eg5 16..368 CDD:276815 18/74 (24%)
KISc 18..366 CDD:214526 18/74 (24%)
DUF342 <325..446 CDD:302792
Microtub_bind 927..1066 CDD:290642
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1048..1067
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.