DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and Klp67A

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001286999.1 Gene:Klp67A / 39068 FlyBaseID:FBgn0004379 Length:814 Species:Drosophila melanogaster


Alignment Length:140 Identity:31/140 - (22%)
Similarity:55/140 - (39%) Gaps:31/140 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRQTKMFGEKAFDLLKELERSSQTIPAFDDDGVRQVLEEIKAIFEENVAQASSYNASGDRSLWP 65
            :..:.|....||    .:|||:..:  .||...::....:|.|::.  .|:....:..|.||...
  Fly   378 LKERNKALEAKA----TQLERAGNS--GFDPLELKTWYSKIDAVYA--AARQLQEHVLGMRSKIK 434

  Fly    66 LLNFRHAALQRNKRCLLAYLYERCRRIKALRWEFGPIIPGDIKQALCEPEVTFFNNYSKSLAAYM 130
            .:|:|    |..|:.|     |..|::..            :.|.:|:.:...|.||..:|.:.|
  Fly   435 NINYR----QTLKKEL-----EEFRKLMC------------VDQRVCQEDFRRFANYMSTLTSQM 478

  Fly   131 CSAGYNQGLP 140
              ..|.:.||
  Fly   479 --EKYKEELP 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 27/124 (22%)
GINS_B 153..201 CDD:425409
Klp67ANP_001286999.1 KISc 8..353 CDD:214526
KISc_KIP3_like 8..346 CDD:276821
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.