DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and cut7

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_594527.1 Gene:cut7 / 2542732 PomBaseID:SPAC25G10.07c Length:1085 Species:Schizosaccharomyces pombe


Alignment Length:190 Identity:39/190 - (20%)
Similarity:64/190 - (33%) Gaps:62/190 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLKELERSSQTIPAFDD---DGVRQVLEEIKAIFEENVAQASSYNASGDRSLWPLLNFRHAALQR 76
            ||..||.|.|.|.....   :|:...|.|::...:|:..|..       :.|..|.|.:|...:.
pombe   693 LLDALEHSLQDISMSSQKLGNGISSELIELQKDMKESYRQLV-------QELRSLYNLQHTHEES 750

  Fly    77 NKRCLLAYLYERCRRIKALRWEFGPIIPGDIKQALCEPEVTFFNNYSKSLAAYMCSAGYNQGLPI 141
            .|..:                 :|  :..|| .||.:...|..|:....|:.|:           
pombe   751 QKELM-----------------YG--VRNDI-DALVKTCTTSLNDADIILSDYI----------- 784

  Fly   142 DLTNNLRPPKSLYIEVRCMEDYGKFELDDGEVI-HLKKNSQHYLPRAQVESL-VRQGILH 199
                              .:...|||....::| ::.|...::| :.|.||| .:..|||
pombe   785 ------------------SDQKSKFESKQQDLIANIGKIVSNFL-QEQNESLYTKADILH 825

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 26/121 (21%)
GINS_B 153..201 CDD:425409 13/49 (27%)
cut7NP_594527.1 KISc_BimC_Eg5 70..429 CDD:276815
KISc 72..428 CDD:214526
SbcC <398..>966 CDD:223496 39/190 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.