DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and psf1

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_595821.1 Gene:psf1 / 2541324 PomBaseID:SPBP23A10.09 Length:202 Species:Schizosaccharomyces pombe


Alignment Length:201 Identity:62/201 - (30%)
Similarity:103/201 - (51%) Gaps:18/201 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GEKAFDLLKELERSS--QTIPAFDDDGVRQVLEEIKAIFEENVAQASSYNASGDRSLWP------ 65
            |.::..|:::.:|:.  ..:|.:..|.|..|:.||:|...|::....:......:...|      
pombe     6 GNRSNKLIRDSKRTQYLDYLPPYQADTVNDVVNEIRAADRESLGILQNVTHEASQPFQPQDHPSE 70

  Fly    66 ---LLNFRHAALQRNKRCLLAYLYERCRRIKALRWEFGPIIPGDIKQALCEPEVTFFNNYSKSLA 127
               ||.| |::...|||||:||...|.:|::...|..|..:...:..:|...|..:...||:.||
pombe    71 AAALLMF-HSSSIYNKRCLMAYHNLRLQRLRQYCWSGGKRMESCLDTSLSTYERDYLTRYSELLA 134

  Fly   128 AYMCSAGYNQGLPIDLTNNLRPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYLPRAQVESL 192
            ||  ...:::   :|||.:|.|||:|:|:||.::|.|..|.:.| .|:|.||||.::....||.|
pombe   135 AY--KGAWSE---LDLTGSLVPPKNLFIDVRVLKDVGDIETEYG-TINLTKNSQLHVRATDVERL 193

  Fly   193 VRQGIL 198
            :.||.|
pombe   194 IAQGFL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 35/135 (26%)
GINS_B 153..201 CDD:425409 20/46 (43%)
psf1NP_595821.1 COG5230 1..202 CDD:227555 62/201 (31%)
GINS_A_psf1 6..140 CDD:212548 35/136 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5230
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I1791
OMA 1 1.010 - - QHG54100
OrthoFinder 1 1.000 - - FOG0003503
OrthoInspector 1 1.000 - - otm47003
orthoMCL 1 0.900 - - OOG6_103148
Panther 1 1.100 - - LDO PTHR12914
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1017
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.860

Return to query results.
Submit another query.