DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and KIF6

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_005248961.1 Gene:KIF6 / 221458 HGNCID:21202 Length:842 Species:Homo sapiens


Alignment Length:206 Identity:42/206 - (20%)
Similarity:64/206 - (31%) Gaps:81/206 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QVLEEIKAIFEENVAQASSYNASGDRSLWPLLNF---RHAA--LQRNKRCLLAYLYERCRRIKAL 95
            |:...:|....::  |...|:...|..|.|.|..   |..|  ...|||             ::.
Human     7 QIFARVKPPVRKH--QQGIYSIDEDEKLIPSLEIILPRDLADGFVNNKR-------------ESY 56

  Fly    96 RWEFGPIIPGDIKQALCEPEVTFFNNYSKSLAAYMCSAGYN----------QGLPIDLTNNLRP- 149
            :::|..|...|..|.      |.|.|.:|.:|..:. ||||          .|....:|..... 
Human    57 KFKFQRIFDQDANQE------TVFENIAKPVAGSVL-AGYNGTIFAYGQTGSGKTFTITGGAERY 114

  Fly   150 ------PKSL--------------------YIEV--RC-------------MEDYGKFEL--DDG 171
                  |::|                    |:|:  .|             :||..|..:  |..
Human   115 SDRGIIPRTLSYIFEQLQKDSSKIYTTHISYLEIYNECGYDLLDPRHEASSLEDLPKVTILEDPD 179

  Fly   172 EVIHLKKNSQH 182
            :.||||..:.|
Human   180 QNIHLKNLTLH 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 22/102 (22%)
GINS_B 153..201 CDD:425409 13/67 (19%)
KIF6XP_005248961.1 Motor_domain 5..343 CDD:277568 42/206 (20%)
Kinesin 11..345 CDD:278646 41/202 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.