DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and kif11

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_775368.2 Gene:kif11 / 195818 ZFINID:ZDB-GENE-020426-1 Length:1062 Species:Danio rerio


Alignment Length:133 Identity:35/133 - (26%)
Similarity:59/133 - (44%) Gaps:41/133 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EKAFDLLKELERSSQTIPAFDDDGVRQVLEEIKAIFEE-NVAQASSYNASGDRSLWPLLNFRHAA 73
            |:..:.:...|:.||..    .:.:.::|:|.|...|| .||||    ..|.||:        .:
Zfish   600 ERCKEQVLNQEKLSQDA----QNSILEILDEHKQHLEEVLVAQA----VPGIRSV--------MS 648

  Fly    74 LQRN-KRCLLAY--LYERCRRIKALRWEFGPIIPGDIKQALCEPEVTFFNNYSKSLAAYM-CS-A 133
            :..| |:.|..|  |.|:.:.:||           |:        :|||:.|::|||:.. |: .
Zfish   649 MNDNLKQTLHKYHNLAEQMQGVKA-----------DM--------MTFFDAYTESLASMRECALQ 694

  Fly   134 GYN 136
            |:|
Zfish   695 GFN 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 33/129 (26%)
GINS_B 153..201 CDD:425409
kif11NP_775368.2 KISc_BimC_Eg5 15..367 CDD:276815
KISc 17..365 CDD:214526
Microtub_bind 926..1061 CDD:290642
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.